SR9009 is one of those subjects where the details matter more than the headlines. This page pulls together the background, the mechanisms, and the practical points readers ask about most.
Last reviewed on 2025-11-17. Where a claim depends on a specific study, the study is described rather than over-claimed.
Quality control for research materials includes identity confirmation by nuclear magnetic resonance and purity assessment by high-performance liquid chromatography. Mass spectrometry provides molecular weight confirmation and can detect related impurities. Purchasers should request a certificate of analysis that lists lot-specific data. Online products advertised for human use often lack such documentation. Distinguishing legitimate research material from mislabeled or contaminated samples is a recurring challenge in independent testing, and independent laboratories may use orthogonal methods to verify identity.
Detection of SR9009 in biological samples usually relies on liquid chromatography coupled to tandem mass spectrometry. This approach separates the compound from matrix components and identifies it by mass transitions. Because SR9009 can undergo metabolism, laboratories often look for both parent drug and specific metabolites. Sample preparation may involve protein precipitation or solid-phase extraction. Method validation examines sensitivity, carryover, and interference from related substances, and reference standards are required for accurate calibration.
Scientific discussion of SR9009 often separates animal evidence from human anecdote. Rodent studies provide controlled data on endurance, metabolism, and gene expression, but they use specific strains, doses, and treatment durations. Human reports are mostly uncontrolled and cannot establish cause and effect. Open questions include oral bioavailability, tissue distribution, metabolic stability, and long-term effects. Review articles generally call for more rigorous pharmacokinetic and safety research before any clinical use could be considered.
Analytical methods for SR9009 typically rely on liquid chromatography coupled with tandem mass spectrometry. The technique can separate the parent compound from related substances and detect low concentrations in biological matrices. Urine and blood are common samples in anti-doping testing, while in vitro studies may use cell culture media. Rapid metabolism and low expected concentrations make method validation important for reliable identification. Exact metabolite patterns can vary by species and are not fully mapped.
| Property | Value | Notes |
|---|---|---|
| Typical storage temperature | -20 °C or lower | Desiccated and protected from light |
| Common analytical method | LC-MS/MS | Detects parent drug and metabolites |
| Solubility class | Lipophilic; soluble in organic solvents | Low aqueous solubility |
| Molecular weight | 437.94 g/mol | Calculated from reported formula |
| Synonyms | SR9009; REV-ERB agonist | Code name used in scientific literature |
SR9009 binds REV-ERB receptors and alters their repressive activity on target genes. This action can change transcription of genes involved in lipid handling, glucose metabolism, and mitochondrial function. In rodent studies, treated animals have shown changes in muscle oxidative capacity and exercise performance, though effects vary by dose, duration, and model. The precise molecular steps connecting receptor binding to whole-body outcomes are still an active area of investigation. Findings in animals do not automatically translate to humans.
Because REV-ERB receptors are core clock components, SR9009 has been examined for effects on daily rhythms as well as metabolism. Research has explored whether the compound can shift or reinforce circadian gene expression in tissues such as liver and muscle. Some studies report improved metabolic markers in obese or diabetic mice, while others show context-dependent responses. Questions remain about which effects are direct, which are secondary to timing, and how they might differ across species.
SR9009 is a synthetic small molecule studied as an agonist of REV-ERB nuclear receptors. REV-ERB alpha and REV-ERB beta help regulate circadian rhythms and metabolic gene expression. In laboratory research, SR9009 has been used to probe how these receptors affect skeletal muscle, liver, and adipose tissue. The compound was identified in academic drug-discovery work and is often described in scientific literature by its chemical name and research code. It is not an approved medicine, and human clinical data remain limited or absent.
Pharmacokinetic data for SR9009 are limited in published literature. Some reports indicate low oral bioavailability and rapid clearance in animals, which complicates interpretation of exposure and effect. Researchers often use injected routes in preclinical work to achieve measurable systemic levels. Analytical studies rely on mass spectrometry to detect the parent compound and its metabolites. Questions about tissue distribution, active metabolites, and long-term consequences remain open. Species differences in metabolism can affect observed half-life and target engagement.
SR9009 is a synthetic small molecule studied as an agonist of the nuclear receptors REV-ERBα and REV-ERBβ. These receptors help regulate circadian rhythms and metabolic gene expression. In laboratory experiments, SR9009 binds these receptors and alters transcription of genes involved in lipid handling, glucose metabolism, and mitochondrial function. It is not a naturally occurring compound and has no approved therapeutic use. Research interest stems from its ability to modify energy metabolism in cells and animal models.
The mechanism of action involves binding to REV-ERB receptors and recruiting corepressor complexes, which represses target gene transcription. This contrasts with many nuclear receptor agonists that activate transcription. Downstream effects may include changes in autophagy, mitochondrial biogenesis, and lipid handling, but the precise pathways remain an active area of study. Whether these molecular events translate into meaningful physiological effects in humans is unresolved. Most evidence comes from cultured cells and rodent models rather than human participants.
SR9009 is a synthetic small molecule developed as an agonist of the nuclear receptors REV-ERBα (NR1D1) and REV-ERBβ (NR1D2). These receptors help regulate circadian rhythms and metabolic gene expression. In cell and animal studies, SR9009 alters transcription of genes involved in lipid metabolism, inflammation, and mitochondrial function. It is not an approved medicine, and its pharmacological profile in humans remains largely uncharacterized. The compound is frequently discussed in the context of circadian biology and metabolic research rather than clinical use.
Stability depends on physical form, temperature, light exposure, and solvent. Solid SR9009 is generally stored cold and dry, with protection from light to limit degradation. Dimethyl sulfoxide stocks are common for laboratory work, but repeated freeze-thaw cycles can reduce compound integrity. Aqueous solutions may be less stable than organic stocks, and the ethyl ester in the structure can be susceptible to hydrolysis under certain conditions. Researchers typically validate storage conditions and recheck purity before quantitative experiments, especially when using archived material.
Regulatory treatment of SR9009 varies by country and region. It is not approved as a pharmaceutical, and several jurisdictions restrict its sale for human consumption. Some authorities classify it as a research chemical, a prescription-only substance, or a prohibited performance-enhancing agent in sport. Purchasers may encounter certificates of analysis, but these documents do not guarantee identity, purity, or legality. In research settings, institutional safety reviews and controlled procurement help ensure that materials are handled under appropriate oversight. The absence of harmonized rules means that legal status can change and requires verification.
Analytical identification of SR9009 typically relies on liquid chromatography coupled with tandem mass spectrometry. In biological samples, researchers first separate the compound from matrix components using protein precipitation, liquid-liquid extraction, or solid-phase extraction. High-performance liquid chromatography with ultraviolet detection and nuclear magnetic resonance spectroscopy can support structural confirmation of reference materials. Because SR9009 is a small, relatively lipophilic molecule, reverse-phase columns and acidic mobile phases are common. Laboratories often include isotope-labeled internal standards to improve quantification and to correct for ion suppression.
== Cause == The cause of lipedema is still unknown. There are various hypotheses about its pathophysiology, including altered adipogenesis, microangiopathy, and damage to the lymphatic system disturbing its microcirculation. Lipedema has been described in familial clusters, suggesting a genetic component. It often appears around times of hormonal change such as puberty, pregnancy, and menopause, suggesting a potential hormonal component. Having obesity does not cause lipedema, but more than half of people with the condition have a BMI higher than 35.
== History == Memphis mayor Watkins Overton put together a commission in 1927 to establish an airport. It was built on a 200-acre (81 ha) plot of farmland seven miles (11 km) from downtown Memphis and opened on June 14, 1929, as Memphis Municipal Airport. The two-day dedication ceremony featured aerial stunts and the arrival of over 200 aircraft. In its early years the airport had three hangars and a sod runway. Standard Oil of Louisiana built the terminal after securing the right to supply all of the airfield's oil and gasoline. In 1930, runway lights were installed after an aircraft landed in the Mississippi River because it could not find the airport at night. Robertson Aircraft Corporation, which would merge into American Airways, started passenger flights to New Orleans and St. Louis in April 1930 on Ryan monoplanes. The following June, American Airways commenced the first airmail service from Memphis. Chicago and Southern Air Lines was headquartered in the city from 1934 to 1935 and from 1941 to 1953, when it was acquired by Delta Air Lines. During the 1930s, Memphis figured on American's east–west route between New York and Los Angeles and on Chicago and Southern's north–south route linking Chicago to New Orleans. The Works Progress Administration helped construct a new terminal building, which was inaugurated in October 1938. It had three stories and an Art Deco design. That year 31,000 passengers used the airport. After the United States entered World War II, the city government leased the airfield to the War Department in July 1942.
=== Virus-induced antiviral immunity === SeV can overcome antiviral mechanisms in some of its natural hosts (some rodents), but the virus is ineffective in overcoming these mechanisms in some other organisms that are virus resistant. Both innate and adaptive immunity promote efficient recovery from SeV infection.
==== Wound healing ==== High dose aspirin treatment (which inhibits cyclooxygenases-1 and -2 to block their production of 12-HHT), thromboxane synthase knockout, and BLT2 receptor knockout, but not TXA2 receptor knockout, impair keratinocyte-based re-epithelialization and thereby closure of experimentally induced wounds in mice. A synthetic BLT2 receptor agonist accelerates wound closure not only in this mouse model but also in the db/db mouse model of obesity, diabetes, and dyslipidemia due to leptin receptor deficiency. 12-HHT accumulated in the wounds of the former mouse model. Companion studies using an in vitro scratch test assay indicated that 12-HHT stimulated human and mouse keratinocyte migration by a BLT2 receptor-dependent mechanism that involved the production of tumor necrosis factor α and metalloproteinases. These results indicate that the 12-HHT/BLT2 receptor axis is a critical contributor to wound healing in mice and possibly humans. The axis operates by recruiting the movement of keratinocytes to close the wound. This mechanism may underlie the suppression of wound healing that accompanies the high dose intake of aspirin and, based on mouse studies, other non-steroidal anti-inflammatory agents (NSAIDs) in humans. Synthetic BLT2 agonists may be useful for speeding the healing of chronic ulcerative wounds, particularly in patients with, for example diabetics, that have impaired wound healing.
== Isoforms == Different isoforms of retinal dehydrogenase exist and play a key role in development, as the types are differentially expressed inside a developing embryo. The enzyme retinal dehydrogenase type-2 (ALDH1A2 or RALDH2) catalyzes much of the retinoic acid formation during development, but not all. ALDH1A2 is crucial for development midgestation and helps drive neural, heart, lung, and forelimb development; it is also responsible for all retinoic acid development during certain periods of midgestation. Later in development, retinal dehydrogenase type-1 (ALDH1A1 or RALDH1) begins activity in the dorsal pit of the retina and retinal dehydrogenase type-3 (ALDH1A3 or RALDH3) becomes active in the olfactory pit, ventral retina, and urinary tract. ALDH1A2 gene knockouts are fatal in mice during development since the brain cannot develop normally. ALDH1A3 gene knockout is fatal at birth in mice since nasal passages are not properly developed and instead are blocked. ALDH1A1 knockouts are not fatal and, interestingly, have been shown to be protective against diet-induced obesity in mice in a retinoid-independent manner.
Sources: en.wikipedia.org
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP.
As early as 1941, integration of the many-body equations of motion was carried out with analog computers. Some undertook the labor-intensive work of modeling atomic motion by constructing physical models, e.g., using macroscopic spheres. The aim was to arrange them in such a way as to replicate the structure of a liquid and use this to examine its behavior. J.D. Bernal describes this process in 1962, writing:... I took a number of rubber balls and stuck them together with rods of a selection of different lengths ranging from 2.75 to 4 inches. I tried to do this in the first place as casually as possible, working in my own office, being interrupted every five minutes or so and not remembering what I had done before the interruption.Following the discovery of microscopic particles and the development of computers, interest expanded beyond the proving ground of gravitational systems to the statistical properties of matter. In an attempt to understand the origin of irreversibility, Enrico Fermi proposed in 1953, and published in 1955, the use of the early computer MANIAC I, also at Los Alamos National Laboratory, to solve the time evolution of the equations of motion for a many-body system subject to several choices of force laws. Today, this seminal work is known as the Fermi–Pasta–Ulam–Tsingou problem. The time evolution of the energy from the original work is shown in the figure to the right.
It makes determinations about what objects to prioritize based on what is especially important to Congress or potentially interesting for the public. The 15 million digitized items represent less than 10% of the library's total 160-million-item collection. The library has chosen not to participate in other digital library projects such as Google Books and the Digital Public Library of America, although it has supported the Internet Archive project.
=== Population structure === The population of P. aeruginosa can be classified in three main lineages, genetically characterised by the model strains PAO1, PA14, and the more divergent PA7. While P. aeruginosa is generally thought of as an opportunistic pathogen, several widespread clones appear to have become more specialised pathogens, particularly in cystic fibrosis patients, including the Liverpool epidemic strain (LES) which is found mainly in the UK, DK2 in Denmark, and AUST-02 in Australia (also previously known as AES-2 and P2). There is also a clone that is frequently found infecting the reproductive tracts of horses.
Sources: en.wikipedia.org
Liquid chromatography-tandem mass spectrometry is a common approach. It can detect the parent compound and its metabolites in biological matrices.
Research samples are typically kept frozen, desiccated, and protected from light. Stock solutions are often aliquoted to reduce freeze-thaw cycles.
High-performance liquid chromatography and nuclear magnetic resonance are standard for purity and identity. Mass spectrometry confirms molecular weight.
No. It is an investigational compound without approved therapeutic indications. It is sold for research purposes only in many jurisdictions.